PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF099600200CFD_t1
Common NameTRAES_3BF099600200CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 391aa    MW: 41826.4 Da    PI: 4.9623
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF099600200CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.25.4e-11308350648
                              HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                              r rr++kN e+A rsR+RK+a + eLe +   L++eN +Lk e
  TRAES3BF099600200CFD_t1 308 RHRRMIKNGESAARSRARKQAFTVELEAELNHLKEENARLKAE 350
                              78**************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-7302367IPR004827Basic-leucine zipper domain
CDDcd147079.85E-21308361No hitNo description
PfamPF077166.2E-9308356IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-9308353No hitNo description
PROSITE profilePS502179.415308350IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.0E-10308350No hitNo description
PROSITE patternPS000360310325IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MASEMSNDVK FSEEEVTSHP RVLEGEEQTV VAPARQSSIF ALTLDELQYS VCEAGRNFGS  60
MNMDEFMSNI WNAEEFQAAT GGGLVGMEMA PVVGAGGGGG GGDAGGSNLA RQESFSLPPT  120
LCQKMVEEVW AEINREPCPV HAQRQAAQPS QQPPVQPSVA ANNRQGTLGE MTLEQFLVKA  180
GMVRGSGAGG QAPVPVDMVH GQMNPAQQGQ QPDTMMYPMA PANGMFPVMG DGMGFIPNVY  240
AGIVVVPPPP PSQGGVGIVS PGSSDGRSAM TQADMMNCMG DGAMMESGGT RKRGASEDQS  300
CERSIECRHR RMIKNGESAA RSRARKQAFT VELEAELNHL KEENARLKAE EKIILLTKKQ  360
MLVEKMIELS KENVNAKKGS TLSRRCGSCI W
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628684.11e-147PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_015628691.11e-147PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLA0A077RTC70.0A0A077RTC7_WHEAT; Uncharacterized protein
STRINGMLOC_34679.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-34ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]